<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
04BR038 04BR038 Brazil 2004 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 PI + RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, M50I, G70N, L74I, L101I, T112V, T124N, K136Q, H171Q, V201I, L234I, I251L, A265V, R269K, D278A  
>04BR038| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLENKIIIVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSNTVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEQLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVLQDNSDIKVVPRRKVKIIKDYGKQMAGADCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, N37K, R41N, H69K, L89M, I93L  
>04BR038| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35M, E36A, T39E, S48T, K122E, D123N, I142T, A158S, K173T, Q174K, T200A, Q207E, R211K, V245Q, A272P, K277R, E291D, V292I, I293V, G335D, R356K, G359T, K366R, T377Q, S379C, K390R, E404D, V435A, L452M, V466I, V467I, D471E, H483Q, L491S, S519N, K527R, K530R, V531I, A534S, A554N  
>04BR038| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPSIFQSSMTKILEPFRTKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVRQLTEAVQKIAQECIVIWGKTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKMGKAGYVTDRGRQKIISLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIRKERIYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Sanabani, S Full-length genome analysis of human immunodeficiency virus type 1 subtype C in Brazil. ARHR, 2006