<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
92RW008_c 92RW008_c Rwanda 1992 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, I72V, T112V, I113V, T124A, T125A, G134N, K136Q, K173R, S195T, V201I, K211R, T218I, L234I  
>92RW008_c| codons 1-276
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLRTAVQMAV
FIHNFKRKGGIGGYTAGERIIDIIATDIQTRELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMA

References
Author Title Citation
Burns, CC Sequence variability of the integrase protein from a diverse collection of HIV type 1 isolates representing several subtypes. ARHR, 2002