<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GHNJ176 GHNJ176 Ghana 2004 HIV1 CRF02_AG PBMC BC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, M50I, I72V, L74I, T112V, I113V, T124A, T125A, V126M, G134D, K136Q, G163E, V165I, V201I, T206P, N222H, L234I S283G, D288N
>GHNJ176| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAMKAACWWADIQQEFGIPYNPQSQGVVESMNKELKKIIEQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIAPDIQTKELQKQITKIQHFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDEN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, K20I, M36I, N37D, R41K, I64M, H69K, L89M K70G
>GHNJ176| codons 1-99
PQITLWQRPLVTVKVGGQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKGAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Tatsumi, M Infectious DNA clones of subtype G and CRF02_AG HIV-1 derived from Ghananian isolates. Direct Genbank Submission, 2006