<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
LV3 LV3 Cameroon 1997 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L74M K14R, V31I, L101I, T112V, T124A, T125A, G134N, I135V, K136T, V201I, T206S, L234I, A265V  
>LV3| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIIMVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    V11F, I13V, K14R, K20I, M36I, N37D, R41K, H69K, L89M  
>LV3| codons 1-99
PQITLWQRPLFTVRIGGQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39L, K104R, K122E, D123G, I135V, S162A, K173T, Q174K, D177E, E194K, T200A, Q207E, V245Q, T286A, E291D, V292I, I293V, P294T, S322A, I326V, G335D, R356K, M357R, G359S, A371V, I375V, V381I, K390R, T403M, V466A, V467I, D471E, Q480H, L491S, S519N, Q524K, K527G, E529D, A534S, A554N  
>LV3| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICLEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLKIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKRRSA
HTNDVKQLTEVVQKVATESIIIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKAISLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEKLIGKDKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Montavon, C Most env and gag subtype A HIV-1 viruses circulating in West and West Central Africa are similar to the prototype AG recombinant virus IBNG. JAIDS, 2000