<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RU98001 RU98001 Russia 1998 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11A, L101V, T112V, T122I, T125A, E157Q, K160Q, V201I, T218I, L234I, S255N  
>RU98001| codons 1-288
FLDGIDKAQEAHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFVLKLAGRWPVKVIHTDNGSN
FISTAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKQLKQIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, R41K, H69K, L89M, I93L  
>RU98001| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  A62V     K11T, V35I, E36D, T39K, I94L, K122Q, I135T, D177E, T200I, Q207D, K277R, T286A, V292I, E297A, E312V, I326V, M357L, G359S, A400T, T403A, L452S, Q480H, V531F T472I
>RU98001| codons 1-560
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALIDICKEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGLPHPAGLKKKKSVTVLDVGDAYFSVPL
DQDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRIKIEELRDHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEIIPLTAEAE
LELAENREILKVPVHGVYYDPSKDLVAEIQKQGQGQWTYQIYQEPFKNLKTGKYARLRSA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWETWWAEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKSGKAGYVTDRGRQKVVSLTDITNQKTELH
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKFYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Liitsola, K An AB recombinant and its parental HIV type 1 strains in the area of the former Soviet Union: Low requirements for sequence identity in recombination. UNAIDS virus isolation network. ARHR, 2000