<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DDJ369 DDJ369 Senegal 2001 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V31I, M50K, I72V, L74I, T112V, T124A, T125A, G134N, K136Q, D167E, V201I, K211Q, T218I, L234I S283G
>DDJ369| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVASCDKCQLKGEAKHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTQELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, M36I, R41K, H69K, L89M  
>DDJ369| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, K11T, V35T, E36A, T39K, K43E, K102Q, K122E, D123G, I135T, I142V, S162Y, K173S, D177E, V179I, Q207A, R211K, F214L, V245Q, E248D, A272P, T286A, E291D, I293V, P294V, E312D, I326V, G335D, M357K, G359S, K366R, T369V, A371V, A376V, E399D, A400T, W410C, E432D, D471E, Q480H, L491S, K512R, L517I, S519N, Q524K, K527E, A534S, A554N  
>DDJ369| codons 1-560
PISPIKTVPVTLKPGMDGPKVKQWPLTEEKIKALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRSQNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDVVVLTEEAE
LELAENREILKDPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLVEVVQKIVTESIVIWGKTPKFKLPIQKETWDTWWTEYWQATCIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEIVNQIIEKLIEKEKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Meloni, ST Distinct human immunodeficiency virus type 1 subtype A virus circulating in West Africa: Sub-subtype A3. J Virol, 2004