<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DDJ360 DDJ360 Senegal 1996 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V31I, I72V, L74I, T112V, T124A, T125A, V126M, G134D, D167E, V201I, L234I, V260I S283G
>DDJ360| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAMKAACWWADIKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVIPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, E35D, M36I, R41K, H69K, L89M  
>DDJ360| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, K11T, V35T, E36A, T39K, K43E, K122I, D123N, I135T, I142V, S162Y, K173L, D177E, V179I, Q207A, R211K, V245Q, K281R, T286A, E291D, V292I, I293V, P294T, E312D, V317A, G335D, M357K, R358K, G359S, A360S, K366R, T369V, A371V, I375V, A376V, E399D, A400T, T403M, W410C, E432D, D471E, Q480H, L491S, E492K, L517I, S519N, Q524K, K527E, A534S, A554S  
>DDJ360| codons 1-560
PISPIKTVPVTLKPGMDGPKVKQWPLTEEKIKALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DINFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRLQNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGAYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKKSS
HTNDVRQLVEVVQKVVTESIVIWGKTPKFKLPIQKETWDTWWMEYWQATCIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSGSKVNIVTDSQYALGIIQAQPDKSESEIVNQIIEKLIEKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Meloni, ST Distinct human immunodeficiency virus type 1 subtype A virus circulating in West Africa: Sub-subtype A3. J Virol, 2004