<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
02UZ694 02UZ694 Uzbekistan 2002 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  L74M D3E, R20K, V31I, E48K, T112V, I113V, S119P, T124S, T125A, G134N, K136Q, D167E, V201I, T218I, L234I, S255N  
>02UZ694| codons 1-288
FLEGIDKAQEEHEKYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGKAMHGQVDCSPGI
WQLDCTHLEGKIIMVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGPN
FTSSAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Carr, JK Outbreak of west African recombinant of HIV-1 in Tashkent, Uzbekistan. JAIDS, 2005