<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
02UZ652 02UZ652 Uzbekistan 2002 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  H51Y, L74M D3E, R20K, V31I, E48K, I72V, T112V, I113V, S119P, T124S, T125A, G134N, K136Q, D167E, V201I, T218I, L234I, S255N  
>02UZ652| codons 1-288
FLEGIDKAQEEHEKYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGKAMYGQVDCSPGI
WQLDCTHLEGKVIMVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGPN
FTSSAVKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, R41K, H69K, V77I, L89M, I93L  
>02UZ652| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  A62V     K11T, V35I, E36D, T39K, V60I, K122E, D123S, A158S, K173L, Q174K, D177E, Q207A, R211S, V245M, E248D, A272P, K277R, T286A, E291D, V292I, I293V, P294T, I326V, G335D, R356K, M357K, R358G, G359S, E370A, A371V, I375V, V381I, K390R, T403M, L452I, S468P, D471E, Q480H, L491S, K512R, E516G, L517I, S519N, Q520K, Q524K, K527E, K530R, A534S, E546K, A554N, K558R  
>02UZ652| codons 1-560
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALIDICKEMEKEGKISKIGPENPYNTPI
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKGSA
HTNDVKQLTAVVQKVATESIIIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKIGKAGYVTDRGRQKVVPLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESGIVNKIIEKLIEKERVYLSWVPAHK
GIGGNKQVDKLVSNGIRRVL

References
Author Title Citation
Carr, JK Outbreak of west African recombinant of HIV-1 in Tashkent, Uzbekistan. JAIDS, 2005