<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE9010 SE9010 Sweden 1995 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 Unknown 52

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E13D, K14R, S24N, V31I, L101I, T112I, T124A, T125A, V126A, K136Q, V165I, V201I, T206S, L234I, D256E S283G
>SE9010| codons 1-288
FLDGIDKAQEEHDRYHSNWRAMANDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGSN
FTSAAAKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, T215F K219Q   A98G E6D, K20R, V35T, V60I, L109I, K122E, D123S, K173T, D177E, G196E, T200A, I202V, Q207E, R211K, V245Q, E248D, D250E, A272P, E291D, V292I, I293V, E297A, E300Q, Q334P, F346Y, M357V, R358K, G359S, T377S, S379G, K390R, A400T, K431T, V435P, F440Y, V467I, S468T, D471E, H483Q, L491S, K512R, E516D, S519N, K527Q, K530R, A534T, A554N K281KN
>SE9010| codons 1-560
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVIDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIEQHRAKVEELREHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCNLLRGTKALTDIVPLTAEAQ
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGPGQWTYQIYQEPYKNLKTGKYARVKSA
HTNDVKQLTEAVQKIASEGIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIPGAETYYVDGAANRETKLGKAGYVTDRGRQKVITLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDRSESDLVNQIIEQLIQKERVYLTWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Wilbe, K Characterization of novel recombinant HIV-1 genomes using the branching index. Virology, 2003