<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CR_98IS002 CR_98IS002 Israel 1998 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, S24N, D25E, V31I, I72V, F100Y, L101I, T112V, S119P, T124A, T125A, K136Q, D167E, V201I, D207N, K211T, L234I  
>CR_98IS002| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMANEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGPN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATNIQTTELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, L63C, H69K, V82I, L89M, I93L  
>CR_98IS002| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QICIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, V35M, T39E, E40G, A98S, K122E, D123S, A158S, K173A, D177E, Q197K, T200A, E203D, Q207E, R211K, V245Q, A272P, K277R, E291D, V292I, I293V, A327V, Q334H, G335D, R356K, G359T, T377M, K390R, E404D, V435A, V466I, D471E, H483Q, L491S, L517I, S519N, K530R, A534S, A554S V111M
>CR_98IS002| codons 1-560
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALMEICEGMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDMGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGKHRAKIDELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIVEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKIVSLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Rodenburg, CM Near full-length clones and reference sequences for subtype C isolates of HIV type 1 from three different continents. ARHR, 2001