<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CM52876 CM52876 Cameroon 2001 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, D25E, V31I, A91E, L101I, T112V, S119R, T124N, T125A, G134N, I135V, K136T, V201I, T206S, L234I, R269K S283G
>CM52876| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPEETGQETAYFILKLAGRWPVKVIHTDNGRN
FTSNAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIKDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, R41K, H69K, L89M  
>CM52876| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, D123E, I142V, K173A, Q174K, D177E, I178L, Q207E, P243A, V245Q, E248D, D250S, A272P, Q278H, T286A, E291D, I293V, E297A, L303M, Q334H, G335D, F346H, R356K, M357R, G359S, T386V, K390R, A400T, L425V, K431T, V435L, L452I, V466I, D471E, L491S, Q509H, S519N, K527Q, A534S, A554T  
>CM52876| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQAIQLPDKSSWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGAKALTDVVPLTAEAE
LEMAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPHKNLKTGKYAKRRSA
HTNDVKQLTEAVQKIATESIVIWGKVPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKVWYQLETEPILGAETFYVDGAANRETKIGKAGYVTDRGRQKIVSLTETTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAHPDKSESELVNQIIEQLIQKEKVYLSWVPAHK
GIGGNEQVDKLVSTGIRKVL

References
Author Title Citation
Carr, JK The AG recombinant IbNG and novel strains of group M HIV-1 are common in Cameroon. Virology, 2001