<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CM53658 CM53658 Cameroon 1997 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, S57G, L101I, T112V, T124A, T125A, G134N, I135V, K136T, V201I, T206S, T218I, L234I, A265V, R269K D288N
>CM53658| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCGPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGDDCVASRQDEN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4S, I13V, K14R, G16E, K20I, E35D, M36I, N37D, H69K, L89M  
>CM53658| codons 1-99
PQISLWQRPLVTVRIEGQLIEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, I135V, S162A, K173A, Q174K, D177E, T200A, Q207E, V245Q, E248A, T286A, E291D, V292I, I293V, P294T, S322A, I326V, G335D, P345T, R356K, M357K, G359S, T369A, A371V, I375V, K390R, K395R, T403M, K431R, E432D, R461K, D471E, Q480Y, L491S, K512R, S519N, Q524E, K527Q, E529D, A534S, A554R  
>CM53658| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPAKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQDQWTYQIYQETFKNLKTGKYAKKRSA
HTNDVKQLAEVVQKVATESIVIWGKTPKFRLPIQRETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLERDPIVGAETFYVDGAANRETKLGKAGYVTDKGRQKVVSLTETTNQKTELY
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEELIQKDKVYLSWVPAHK
GIGGNEQVDKLVSRGIRKVL

References
Author Title Citation
Carr, JK The AG recombinant IbNG and novel strains of group M HIV-1 are common in Cameroon. Virology, 2001