<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TY_pat1 TYmIDU103 Myanmar 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17C, A91T, L101I, K111R, S119R, T124N, T125A, G163E  
>TYmIDU103| codons 1-288
FLDGIDKAQEEHEKYHCNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPTETGQETAYFILKLAGRWPVRTIHTDNGRN
FTSNAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIEQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19T, E35D, I62V, L63P, I93L  
>TYmIDU103| codons 1-99
PQITLWQRPLVTIKIGGQTKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K219E     K49E, I135V, S162C, R211K, A272P, K275R, K277R, Q278E, D324E, Q334L, P345Q, F346Y, V435E, N447S, D460N, R461K, S468T, H483L, L491V, D511G, V548I, A554G, K558R  
>TYmIDU103| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISEIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRELCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGLGQWTYQIYQEQYKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AILLALQDSGVEVNIVTDSQYALGIIQAQPGKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQIDKLVSGGIRRVL

References
Author Title Citation
Takebe, Y High prevalence of diverse forms of HIV-1 intersubtype recombinants in Central Myanmar: Geographical hot spot of extensive recombination. AIDS, 2003