<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TY_pat4 TYmSTD101 Myanmar 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6E, E11D, S17C, V31I, A91T, L101I, S119R, T124N, T125S, I162V, G163E, K173E, K188E, K211R, S230N  
>TYmSTD101| codons 1-288
FLDGIEKAQEDHEKYHCNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPTETGQETAYFILKLAGRWPVKTIHTDNGRN
FTSNSVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIVEQVRDQAEHLETAVQMAV
FIHNFKREGGIGGYSAGERIVDIIATDIQTRELQKQITKIQNFRVYYRDNRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37D, L63P, I93V  
>TYmSTD101| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQVGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y       K82R, I135V, I142V, S162C, E203D, R211K, Q278E, I293V, D324E, I326V, Q334L, F346Y, R356K, A400T, T403V, V435E, A437V, K454R, D460N, R461K, V467I, S468T, H483N, L491V, V548I, K558R  
>TYmSTD101| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIDELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKELCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELVAEIQKQGLGQWTYQIYQEPYKNLKTGKYAKMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWETWWVEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGVETFYVDGAANRETKLGRAGYVTNKGRQKVITLTDTTNQKTELQ
AINLALQDSGVEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQIDKLVSAGIRRVL

References
Author Title Citation
Takebe, Y High prevalence of diverse forms of HIV-1 intersubtype recombinants in Central Myanmar: Geographical hot spot of extensive recombination. AIDS, 2003