<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
99ET7 99ET7 Ethiopia 1999 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S24N, D25E, M50I, I72V, F100Y, L101I, T112V, T124A, T125A, K136Q, D167E, V201I, T218I, L234I, R269K, D278A S283G
>99ET7| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMANEFNLPPVVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYYILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIKDYGKQMAGADCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, M36I, R41K, H69K, L89M, I93L  
>99ET7| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K122E, D123S, K166R, K173A, D177E, T200A, Q207G, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, Q334D, G335D, R356K, G359T, T369V, E370G, T377M, S379G, T386I, K390R, A400T, E404D, E413D, A437V, L452I, V466I, D471E, T477A, H483Q, L484I, L491S, S519N, K530R, V531I, A534T, A554N  
>99ET7| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRGHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGDDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLVGAVQKIAMEGIVIWGKIPKFRLPIQKETWETWWTDYWQATWIPDWEFVNTP
PLVKLWYQLEKEPIVGVETFYVDGAANRETKIGKAGYVTDRGRQKIVSLTETTNQKAELQ
AIQIALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERIYLTWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Harris, ME A cluster of HIV type 1 subtype C sequences from Ethiopia, observed in full genome analysis, is not sustained in subgenomic regions. ARHR, 2003