<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ZA_BL ZA_BL DRC 1996 HIV1 G Unknown None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, R20K, V31I, L101I, T112I, T124A, T125A, G134S, K136T, V201I, T206S, L234I, S255N, D256E S283G
>ZA_BL| codons 1-288
FLDGIDKAQEEHERYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGSN
FTSAAVKAACWWASITQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12K, I13V, K14R, K20I, M36I, N37D, R41K, C67S, H69K, K70R, V82I, L89M  
>ZA_BL| codons 1-99
PQITLWQRPIVKVRIGGQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEISGKRAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R     A98G K20R, V35T, T39N, V60I, K102Q, K104R, K122E, D123N, I135T, N147X, V148X, L149X, K173T, D177E, T200A, Q207E, V245Q, E248N, D250E, S251N, A272P, L283I, T286A, E291D, V292I, I293V, P294S, L295M, E297A, L301M, I329V, Q334L, I341V, F346Y, R356K, M357G, R358G, G359S, A371V, S379G, V381I, T386I, Q394K, A400V, K431T, V435P, A437V, F440Y, R461K, V466I, V467I, S468T, D471E, T477A, Q480H, H483Q, G490Q, L491S, K512R, L517I, S519N, A534S, A554S Q91P, K465I
>ZA_BL| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPI
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVPLGIPHPGGLKQKRSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYXXXPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKENWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGAKALTDIVSMTAEAE
MELAENREILKEPVHGVYYDPSKDLIAEVQKQGLGQWTYQVYQEPYKNLKTGKYAKGGSA
HTNDVKQLTEVVQKIATEGIIIWGKIPKFKLPIKKETWEVWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIPGVETYYVDGAANRETKLGKAGYVTDKGRQIIITLTETTNQKAELH
AIQLALQDSQSEVNIVTDSQYALGIIQAQPDRSESEIVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Oelrichs, RB Full-length genomic sequence of a subtype G HIV-1 from Kinshasa. ARHR, 1999