<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
patient_98BRRJ045 98BRRJ045 Brazil 2003 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, L45Q, I72V, L74I, T112V, I113V, T124S, T125A, V201I, A205S, N222H, L234I  
>98BRRJ045| codons 1-258
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQQKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSSAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTKELQKQITKIQHFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIK

References
Author Title Citation
Couto-Fernandez, JC Phylogenetic analysis of Brazilian HIV type 1 subtype D strains: Tracing the origin of this subtype in Brazil. ARHR, 2006