<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
patient_96BRRJ100 96BRRJ100 Brazil 1996 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  V151I E10D, E11D, V32I, D41N, I72V, I84L, L101I, S119T, D167E, S195T, V201I, T218I, A265V  
>96BRRJ100| codons 1-288
FLDGIDKAQDDHEKYHSNWRAMASDFNLPPVIAKEIVASCNKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYTAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Couto-Fernandez, JC Phylogenetic analysis of Brazilian HIV type 1 subtype D strains: Tracing the origin of this subtype in Brazil. ARHR, 2006