<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
patient_04BRSAP19 04BRSAP19 Brazil 2003 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E10D, E11D, M50I, I72V, T112V, I113V, T124A, V201L, Q216P  
>04BRSAP19| codons 1-230
FLDGIDKAQDDHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERILDIIATDIQTKELQKPITKIQNFRVYYRDS

References
Author Title Citation
Couto-Fernandez, JC Phylogenetic analysis of Brazilian HIV type 1 subtype D strains: Tracing the origin of this subtype in Brazil. ARHR, 2006