<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
patient_05BRRJ095 05BRRJ095 Brazil 2003 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E10D, R20K, I72V, L74I, I84V, P90A, G106A, T112M, T124A, T125A, G193E, V201I, D207N, K211Q, L234I, N254K  
>05BRRJ095| codons 1-259
FLDGIDKAQDEHEKYHSNWKAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYVEAEVIAAETGQETAYFLLKLAARWPVKMIHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGEYSAGERIIDIIATNIQTQELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDKSDIKV

References
Author Title Citation
Couto-Fernandez, JC Phylogenetic analysis of Brazilian HIV type 1 subtype D strains: Tracing the origin of this subtype in Brazil. ARHR, 2006