<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01IC_PCI127 01_PCI127 Cote d'Ivoire 2001 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, D25E, V31I, M50I, T112V, T124A, T125A, G134N, I135V, K136T, K188R, V201I, T206S, L234I, A265V S283G
>01_PCI127| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRRGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F I13V, K20I, M36I, R41K, L63P, H69K, I72E, L89M K70H
>01_PCI127| codons 1-99
PQITLWQRPFVTVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKHAEGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, I135T, S163T, T165I, K173A, Q174K, D177E, T200A, I202V, Q207E, R211K, F214L, E248D, S251C, K275Q, T286A, E291D, V292I, I293V, P294T, E300D, K311R, I326V, G335D, R356K, M357K, G359S, K366R, A371V, I375V, A376T, T377P, V381I, E399D, A400T, T403A, E432D, V435M, A446S, D471E, Q480H, H483Y, L491S, K512R, S519N, Q524K, K527E, E529N, A534S, A554N  
>01_PCI127| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSTMIKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDCWTVNDIQKLVGKLNWASQIYAGIQVKQLCKLLRGAKALTDIVTLTEEAD
LELAENREILREPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLTEVVQKVTPESIIIWGKTPKFKLPIQKETWDTWWAEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIMGAETFYVDGASNRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIEKNKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Toni, T Presence of CRF09_cpx and complex CRF02_AG/CRF09_cpx recombinant HIV type 1 strains in Cote d'Ivoire, West Africa. ARHR, 2005