<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01IC_17395 01_17395 Cote d'Ivoire 2001 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V32I, S39N, L45Q, L101I, T112V, I113V, T124A, T125A, G134N, K136T, V201I, T206S, L234I, D270H S283G
>01_17395| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPVIAKEIVANCDKCQQKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWANITQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRHYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I13V, K14R, G16E, K20I, M36I, R41K, L63M, H69K, L89M  
>01_17395| codons 1-99
PQITLWQRPLVKVRIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIMIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, T39L, I135T, K173I, Q174K, D177E, T200A, Q207E, R211K, P243S, V245Q, E248D, K249Q, D250E, T286A, E291D, V292I, I293V, P294T, G335D, R356K, M357K, G359S, A371V, I375V, A376I, I380V, A400T, T403A, E432D, V435M, R461K, D471E, Q480H, H483Y, L491Q, K512R, S519N, Q524K, K527E, A534S, A554N, K558R  
>01_17395| codons 1-560
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIQLPDQESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVITESVVIWGKTPKFKLPIQKETWETWWAEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIMGAETFYVDGAANRETKLGKAGYVTDKGRQKVVSLTETTNQKTELH
AIYLALQDSGQEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIEKEKVYLSWVPAHK
GIGGNEQVDKLVSNGIRRVL

References
Author Title Citation
Toni, T Presence of CRF09_cpx and complex CRF02_AG/CRF09_cpx recombinant HIV type 1 strains in Cote d'Ivoire, West Africa. ARHR, 2005