<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE7535 SE7535 Sweden 1994 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V31I, I72V, L101I, T112V, T124A, T125A, G134N, I135V, D167E, K188R, V201I, L234I, A265V S283G
>SE7535| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRRGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVAGRQDED

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, D121H, K122E, D123G, I135T, E138A, K173E, Q174R, D177E, I178V, V179I, Q207E, R211S, D250E, K277R, T286A, E291D, V292I, I293V, P294T, E312D, V317A, A327V, G335D, P345T, M357K, G359S, T369A, A371V, I375V, T377M, K388R, F389S, A400T, T403I, E404D, E432D, D460N, D471E, Q480H, H483L, L491S, K512R, S519N, Q524K, K527G, E529D, A534S, A554S V111L, L234V
>SE7535| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDLGDAYFSVPL
HEGFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRERNPEVII
YQYMDDLYVGSDLEIGQHRTKIEELREHLLSWGFTTPDKKHQKEPPFLWMGYEVHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGAYYDPSKDLIVEIQKQGQDQWTYQIYQETFKNLKTGKYARKRSA
HTNDVKQLAEVVQKVAMESIVIWGKTPRSKLPIQKETWETWWIDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVSLTETTNQKTELH
AILLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIGKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Carr, JK Characterization of subtype A HIV-1 from Africa by full genome sequencing. AIDS, 1999