<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
99US_MSC1134 99US_1134 U.S. 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, L101I, T112V, T124A, T125A, G134N, I135V, K136T, V201I, T206S, T218I, L234I, D256E S283G
>99US_1134| codons 1-287
FLDGIDKAQEEHERYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I I13V, K20I, M36I, R41K, L63LP, C67CY, H69K, I72M, L89I  
>99US_1134| codons 1-99
PQITLWQRPLITVKIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEIYGKKAMGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, T39A, E40D, K49R, V60I, I135V, K173I, Q174K, D177E, T200A, E204K, Q207E, R211K, V245E, S251C, K277R, K281R, T286A, E291D, V292I, I293V, P294T, P321S, S322T, I326V, G335D, R356K, M357K, G359S, A371V, I375V, K390R, K395R, T403M, K431R, E432D, T470N, D471E, Q480H, L491S, K512R, S519N, Q520L, Q524K, K527E, E529D, A534S, A554S  
>99US_1134| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICADMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEKLREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDCWTVNDIQKLVGKLNWASQIYAGIKVRQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDSTKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVKQLTEVVQKVATESIVIWGKTPKFRLPIQRETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLERDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLNETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNLIIEKLIEKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Tovanabutra, S Characterization of complete HIV type 1 genomes from non-B subtype infections in U.S. military personnel. ARHR, 2005