<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
00US_MSC1164 00US_1164 U.S. 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V31I, S39N, T112V, T124A, T125A, G134N, I135V, G163E, D167E, V201I, L234I, S255N S283G
>00US_1164| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVANCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVKQEFGIPYNPQSQGVVESMNKELKKIIEQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, V82I, L89M  
>00US_1164| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, K43E, K122E, D123N, K173I, Q174K, D177E, Q207A, R211S, I244V, V245E, T286A, E291D, V292I, E312N, I329V, G335D, M357K, R358G, G359S, K366R, A371V, S379G, K390R, A400T, T403M, E432D, D460N, D471E, Q480H, L491S, K512R, L517V, S519N, Q524E, A534S, A554S K13R
>00US_1164| codons 1-560
PISPIDTVPVTLRPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIIPLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKGSA
HTNDVRQLTEVVQKIATEGIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEVVNQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Tovanabutra, S Characterization of complete HIV type 1 genomes from non-B subtype infections in U.S. military personnel. ARHR, 2005