<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML752_3_1997 752_3_1997 Kenya 1997 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97A K14R, A21T, V31I, I60M, I72V, T112V, I113V, T124A, T125A, V126F, G134N, K136Q, D167E, V201I, Q216H, L234I  
>752_3_1997| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGM
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQEAAYFLLKLAGRWPVKVVHTDNGSN
FTSAAFKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKHITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, R57K, L63S, H69K, L89M  
>752_3_1997| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, K122E, D123G, I135T, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S, V245M, D250E, T286A, E291D, V292I, I293V, E312D, G335D, M357K, G359S, A371V, I375V, A376V, T377M, A400T, T403M, E404D, E432D, V435A, V467I, D471E, Q480H, L491S, Y501F, K512R, S519N, Q524K, K527G, E529D, A554S  
>752_3_1997| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVKQLTEVVQKVVMESIVIWGKTPKFKLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKVISLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQFALGIIQAQPDRSESELVNQIIEKLIGKDKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Fang, G Long-term survivors in Nairobi: Complete HIV-1 RNA sequences and immunogenetic associations. J Infect Dis, 2004