<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML672_3_1997 672_3_1997 Kenya 1997 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V31I, I72V, L101I, T112V, I113V, T124A, T125A, K136Q, V201I, Q216H, I220V D288N
>672_3_1997| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKHITKVQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDEN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, N37D, R41K, R57K, I62V, H69K, L89M  
>672_3_1997| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        P4H, V35T, V60I, D121H, K122E, D123S, I135T, K173A, D177E, I195T, T200A, Q207E, V245Q, T286A, E291D, V292I, I293V, P294T, I326T, G335D, F346Y, R356K, M357R, G359T, T377L, K390R, E404D, E432D, V435I, D471E, Q480H, G490E, L491S, K512R, S519N, Q524K, K527G, E529D, A534S, A554S  
>672_3_1997| codons 1-560
PISHIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLETGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLTAEIQKQGQDQWTYQIYQEPYKNLKTGKYAKRRTA
HTNDVKQLTEAVQKIALESIVIWGKTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSESEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIGKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Fang, G Long-term survivors in Nairobi: Complete HIV-1 RNA sequences and immunogenetic associations. J Infect Dis, 2004