<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01BR323 01BR323 Brazil 2001 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 PI|RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  V151I A21S, I113V, L234V, D256E S283G, R284G
>01BR323| codons 1-288
FLDGIDKAQEEHEKYHSNWRSMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGGQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, E35D, M36I, R41K, R57K, D60E, Q61D, L63S, L89M  
>01BR323| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
DISIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       K20R, V35T, T39K, K43E, E44A, V118I, K122E, E138A, S162C, E169D, K173T, Q174K, N175Y, Q197E, Q207E, R211K, V245Q, E248D, A272P, Q278H, T286A, E291D, V292I, I293V, E297A, I329L, R356K, G359S, E370D, A376S, T377L, T386I, K390R, A400T, T403R, K431T, V435A, A446S, L452K, V466A, D471E, T477A, H483Q, L491T, A502V, S519N, K527N, A534S, A554T  
>01BR323| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICKELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRTKYPDIVI
YQYMDDLYVGSDLEIGEHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTDAVQKISLESIVIWGKIPKFRLPIQKETWETWWREYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRETKKGKAGYVTDRGRQKAVSLTETTNQKAELQ
AIQLALQDSGTEVNIVTDSQYVLGIIQAQPDKSESELVNQIIEQLINKEKVYLSWVPAHK
GIGGNEQVDKLVSTGIRKVL

References
Author Title Citation
Sanabani, S Analysis of the near full length genomes of HIV-1 subtypes B, F and BF recombinant from a cohort of 14 patients in Sao Paulo, Brazil. Infect Genet Evol, 2006