<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
99UFRJ_16 99UFRJ_16 Brazil 2000 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  G163K S17N, I72V, L101I, S119T, T122I, T124A, T125A, K136Q, V201I, A205S, L234V, D256E S283G
>99UFRJ_16| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FISAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIKQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, R57K, Q61N, L89M  
>99UFRJ_16| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35A, D123E, S162Y, E169D, K173A, Q174K, Q207E, R211K, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297T, R356K, G359S, K366R, A376S, T377L, T386I, Q394L, E399D, A400T, K431T, V435A, A446S, L452K, V466A, D471E, T477A, H483Q, L491S, S519N, K527N, A534S  
>99UFRJ_16| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALAEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRAKNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVRQLTEAVQKISLESIVIWGKIPKFKLPILKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRETKKGKAGYVTDRGRQKAVSLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLINKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Thomson, MM Analysis of near full-length genome sequences of HIV type 1 BF intersubtype recombinant viruses from Brazil reveals their independent origins and their lack of relationship to CRF12_BF. ARHR, 2004