<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
94BR_RJ_41 94BR_RJ_41 Brazil 1994 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  G163R E11D, V37I, I72V, I73V, I84L, L101I, S119T, T124A, T125A, K136Q, Q168H, V201I, A205S, K211R, T218I, L234V, D256E  
>94BR_RJ_41| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPVVAKEIIASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVVLVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIRQVRDHAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I15V, E35D, M36L, R41K, R57K, D60E, Q61E, I62V, L89M, Q92K  
>94BR_RJ_41| codons 1-99
PQITLWQRPLVKIKVGGQLKEALLDTGADDTVLEDLNLPGKWKPKMIGGIGGFIKVKQYE
EVLIEICGHKAIGTVLVGPTPVNIIGRNMLTKIGCTLNF

References
Author Title Citation
Thomson, MM Analysis of near full-length genome sequences of HIV type 1 BF intersubtype recombinant viruses from Brazil reveals their independent origins and their lack of relationship to CRF12_BF. ARHR, 2004