<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
99UFRJ_2 99UFRJ_2 Brazil 2000 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 56

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, I72V, I84L, L101I, S119T, T124A, G163E, V165I, V201I, T206S, T218I, L234V R284RG, D288N
>99UFRJ_2| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIEQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASGQDEN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, E35D, M36I, R41K, I64V, N98NH  
>99UFRJ_2| codons 1-99
PQITLWQRPVVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLHF

References
Author Title Citation
Thomson, MM Analysis of near full-length genome sequences of HIV type 1 BF intersubtype recombinant viruses from Brazil reveals their independent origins and their lack of relationship to CRF12_BF. ARHR, 2004