<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
94BR_RJ_97 94BR_RJ_97 Brazil 1994 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, V32I, L45Q, I72IV, I84L, L101I, S119T, T124A, K136Q, V165I, V201I, K211R, T218I, L234V, D256E S283G
>94BR_RJ_97| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVIAKEIVASCDKCQQKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGTN
FTSATVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTRELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, K20R, E35D, M36I, P39Q, R41K, R57K, Q61N, I72T, V82I, L89M  
>94BR_RJ_97| codons 1-99
PQITLWQRPLVTIKVGGQLREALLDTGADDTVLEDINLQGKWKPKMIGGIGGFIKVKQYD
NILIEICGHKATGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39M, K49R, D123E, I135L, S162C, E169N, K173A, Q174K, I178L, G196E, T200A, Q207E, R211K, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, I293V, E297A, V317A, R356K, G359S, T377L, Q394L, A400T, V417I, K431T, A446S, L452Q, V466A, D471E, T477A, H483Q, L491S, S499T, S519N, K527N, A534S, V559I  
>94BR_RJ_97| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICMEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILNPFRAKNPDLVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEAVQKIALESIVIWGKTPKFKLPILKETWETWWTEYWQATWIPEWEFINTP
PLVKLWYQLETEPIVGAETFYVDGASNRETKQGKAGYVTDRGRQKAVSLTETTNQKAELQ
AIQLALQDSGSEVNIVTDTQYALGIIQAQPDKSESELVNQIIEQLINKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKIL

References
Author Title Citation
Thomson, MM Analysis of near full-length genome sequences of HIV type 1 BF intersubtype recombinant viruses from Brazil reveals their independent origins and their lack of relationship to CRF12_BF. ARHR, 2004