<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
99UFRJ_1 99UFRJ_1 Brazil 2000 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 3TC+ D4T 24
2 3TC+ D4T+ NVP+ NFV 39

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, E13K, S17N, V31I, I72V, I84L, L101I, S119P, T122I, T125A, K136Q, K156N, V165I, V201I, A205S, K211R, T218S, L234V, D256E S283G
>99UFRJ_1| codons 1-288
FLDGIDKAQEDHKKYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYLEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGPN
FISTAVKAACWWAGIQQEFGIPYNPQSQGVVESMNNELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIISTDIQTRELQKQISKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, R57K, D60E, Q61D, V77I, L89M  
>99UFRJ_1| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
DILIEICGHKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    V106A   K49R, D123E, R211K, E248V, A272P, I293V, I329L, F346Y, M357A, Q394L, A400T, E404D, E413D, K431T, V435A, A446S, L452K, R461K, V466A, V467I, D471E, K476R, T477A, H483Q, L491S, L517I, S519N, K530KR, A534S, E546K, V559I  
>99UFRJ_1| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPVKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPYKNLKTGKYARARGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPILKETWETWWTDYWQATWIPDWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGASNRETKKGKAGYVTDKGRQKAISLTETTNQRAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEQLIKKERVYLSWVPAHK
GIGGNKQVDKLVSAGIRKIL

References
Author Title Citation
Thomson, MM Analysis of near full-length genome sequences of HIV type 1 BF intersubtype recombinant viruses from Brazil reveals their independent origins and their lack of relationship to CRF12_BF. ARHR, 2004