<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BB_96TH_NP1538 96TH_1538 Thailand 1996 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    G70E, S119R, T124N, T125A, K211R  
>96TH_1538| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEEKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGRN
FTSNAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTRELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, W42*, I62V, L63P, I93L  
>96TH_1538| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGR*KPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I135V, S162C, Q197E, Q207K, R211K, V245M, E248V, K277R, Q278E, T286A, E297K, E312V, I329L, Q334L, F346C, R356K, T369A, V435E, D460N, R461K, S468T  
>96TH_1538| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGEHRTKIEELRKHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPVKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLLRGAKALTEVIPLTKEAE
LELAENREILKVPVHGVYYDPSKDLIAELQKQGLGQWTYQIYQEPCKNLKTGKYAKMRGA
HTNDVKQLAEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGAETFYVDGAANRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Brown, BK Biologic and genetic characterization of a panel of 60 human immunodeficiency virus type 1 isolates, representing clades A, B, C, D, CRF01_AE, and CRF02_AG, for the development and assessment of candidate vaccines. J Virol, 2005