<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KNH1271 KNH1271 Kenya 2000 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S24H, L28I, S39C, L45I, M50I, I72V, L101I, T112V, S119P, T124A, K136Q, D167E, K215R, L234I S283G
>KNH1271| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMAHDFNIPPVVAKEIVACCDKCQIKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGPN
FTSATVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQRQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, G16E, E35D, M36I, P39S, R41K, K43R, L63T, G68E, H69K, K70R, L89M, T91V  
>KNH1271| codons 1-99
PQITLWQRPVVTVRIEGQLKEALLDTGADDTVLEDINLSGKWRPKMIGGIGGFIKVRQYD
QITIEICEKRAIGTVLVGPTPVNIIGRNMLVQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I2V, P4T, V35T, T39K, K43E, D121H, K122E, I135T, D177E, Q207E, R211K, V245E, A272G, K277R, K281R, E291D, V292I, I293V, E297R, A304E, E312N, D324E, G335D, R356K, M357K, G359S, A360T, T377M, K390R, A400T, Y405H, T409N, V435A, R463K, V466I, D471E, K476R, Q480H, H483Y, L491V, K512R, E514D, S519N, Q524K, K527E, K530R, A534S, V548I, A554S  
>KNH1271| codons 1-560
PVSTIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYGGIKVRQLCRLLRGTKALTDIVPLTREAE
LELEENREILKNPVHGVYYDPSKELIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRST
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTEHWQANWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKLGKAGYVTDRGKQKIVSLTETTNQRTELH
AIYLALQDSGVEVNIVTDSQYALGIIQAQPDRSDSELVNQIIEKLIEKERVYLSWVPAHK
GIGGNEQIDKLVSSGIRKVL

References
Author Title Citation
Visawapoka, U Circulating and unique recombinant forms of HIV Type 1 containing subsubtype A2. ARHR, 2006