<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CF4071 CF4071 Central African Republic 1990 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, A21T, V31I, S39N, I72V, T112V, T124A, G134N, I135V, K136Q, D167E, V201I, Q216H, L234I S283G
>CF4071| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVANCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSATVKAACWWANVQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKHITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36I, R41K, L63I, H69K, L89M  
>CF4071| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIIIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, K43E, D121H, K122E, D123S, F124FL, K154R, S162C, K173A, Q174K, D177E, Q207A, R211S, P225S, K238R, V245Q, E248D, D250E, N255D, T286A, E291D, V292I, I293V R199G
>CF4071| codons 1-300
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESLRKYTAFTIPSINNETPGIRYQYNVLPQGWRGSPAIFQCSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHGTKIEELRAHLLSWGFTTPDKKHQKESPFLWMGYELHPDRWT
VQPIQLPDKESWTVDDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTEEAE

References
Author Title Citation
Anderson, JP Testing the hypothesis of a recombinant origin of human immunodeficiency virus type 1 subtype E. J Virol, 2000