<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
93TH057 93TH057 Thailand 1993 HIV1 CRF01_AE PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
S147G   K14R, A21T, V31I, S39N, I72V, T112V, T124A, T125A, G134N, I135V, K136R, K160E, D167E, V201I, L234I S283G
>93TH057| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVANCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVRQEFGIPYNPQGQGVVESMNKELKEIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>93TH057| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, K43E, R83G, K122E, D123S, K173I, Q174K, D177E, I178M, Q207A, R211S, K238R, V245E, L282P, E291D, V292I, I293V, E312T, I326V, I329V, G335D, M357K, G359S, K366R, A371V, K390R, K395R, A400T, T403M, E432D, N447S, D471E, Q480H, L491S, K512R, L517V, S519N, Q524E, A534S, N545D, A554S N137D
>93TH057| codons 1-560
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKGTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINDETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKPLRGTKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLTEVVQKIATESIVIWGKTPKFRLPIQRETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAASRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEVVNQIIEELIKKEKVYLSWVPAHK
GIGGDEQVDKLVSSGIRKVL

References
Author Title Citation
Anderson, JP Testing the hypothesis of a recombinant origin of human immunodeficiency virus type 1 subtype E. J Virol, 2000