<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PCM039 PCM039 Colombia 2001 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  V54I S39C, M50I, T124N, I141V, A175V, V201I, L234I  
>PCM039| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVACCDKCQLKGEAIHGQIDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSNTVKAACWWAGIKQEFGVPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTVVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L33V, R41K, D60E, I64V  
>PCM039| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYE
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, R83K, K122Q, I178L, G196E, R211K, A272S, K281R, E297S, Q334D, K350R, M357T, T377R, T397S, A400L, E404D, V435L, L452I, R461K, S519N, Q520L, A554S  
>PCM039| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DQDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCRLLRGTKALTEVIPLTSEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGDGQWTYQIYQEPFKNLRTGKYARTRGA
HTNDVKQLTEAVQKIARESIVIWGKTPKFKLPIQKESWELWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPILGAETFYVDGAANRETKIGKAGYVTDKGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNLIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Sanchez, GI Molecular epidemiology of human immunodeficiency virus-infected individuals in Medellin, Colombia. Am J Trop Med Hyg, 2006