<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PCM013 PCM013 Colombia 2001 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, I72V, S119T, T124A, T206S, E212G, I220L, Y227F, D253Y, A265V R284G
>PCM013| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGTN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTKGLQKQITKLQNFRVYFRDSRDPLWKGPAK
LLWKGEGAVVIQYNSDIKVVPRRKVKIIRDYGKQMAGDDCVASGQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
>PCM013| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        R83K, K102Q, D123E, I135T, S162C, I178L, R211G, A272P, L295I, E297K, D324E, G335D, G359S, T377M, K390R, E404D, V435L, D460N, R461K, Q480H, L503I  
>PCM013| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPITKEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPILGAETFYVDGAANRETKLGKAGYVTNKGRQKVVSLTDTTNQKTELH
AIHLALQDSGLEVNIVTDSQYAIGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Sanchez, GI Molecular epidemiology of human immunodeficiency virus-infected individuals in Medellin, Colombia. Am J Trop Med Hyg, 2006