<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
00BW2276 00BW2276 Botswana 2000 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, V31I, M50I, I72V, I84M, L101I, T112V, K136Q, K188R, V201I, L234I, A265V, R269K, D278A S283G
>00BW2276| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYMEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSTTVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRRGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, M36I, R41K, H69K, V77I, L89M, I93L  
>00BW2276| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35M, T39A, S48T, E53D, K122E, D123G, K166R, K173A, T200A, Q207E, R211K, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, K323E, Q334H, G335D, R356K, G359T, T377L, K390R, A400T, E404D, V435A, L452I, V466I, T470S, D471E, H483Q, L491S, S519N, A534S, A554K A267V
>00BW2276| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAEMEKEGKITKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWVSQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSEDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIALESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKIGKAGYVTDRGRQKIVSLSETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSKGIRKVL

References
Author Title Citation
Novitsky, V Human immunodeficiency virus type 1 subtype C molecular phylogeny: consensus sequence for an AIDS vaccine design? J Virol, 2002