<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
00BW2036 00BW2036 Botswana 2000 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D25E, V31I, M50I, L74I, V77A, L101I, T112V, T124A, T125A, K136Q, V201I, L234I, A265V, R269K, D278A S283G
>00BW2036| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKIIIVAAHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKDYGKQMAGADCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, N37S, R41K, L63P, H69K, V77I, L89M, I93L  
>00BW2036| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11R, V35T, E36A, T39E, S48T, K122E, D123N, K173A, Q174K, D177E, I178L, T200A, K201R, Q207K, V245K, D250E, A272P, T286A, E291D, V292I, I293V, K311R, E312G, I326V, Q334H, G335D, Y342F, R356K, G359T, T377M, K390R, A400T, E404D, V435I, V466I, V467I, D471E, H483Q, L491S, S519N, K530R, A534S, A554R D256G, L301V
>00BW2036| codons 1-560
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPELVI
YQYMDDLYVGSDLEIGQHRARIEELRKHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNGIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
VELAENREILRGPVHGVYYDPSKDLVAEIQKQGHDQWTYQIFQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKIISLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSRGIRKVL

References
Author Title Citation
Novitsky, V Human immunodeficiency virus type 1 subtype C molecular phylogeny: consensus sequence for an AIDS vaccine design? J Virol, 2002