<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
00BW1471 00BW1471 Botswana 2000 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97A K14R, S24N, D25E, V31I, I72V, L101I, K111Q, T112I, T124A, T125A, K136Q, Q177L, T206S, D232E, L234V, D278A E152K, S283G
>00BW1471| codons 1-288
FLDGIDKAQEEHERYHSNWRAMANEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQEAAYFILKLAGRWPVQIIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVKSMNKELKKIIGQVRDQAEHLKTAVLMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTKELQKQITKIQNFRVYYRDSREPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGADCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, R41K, L63V, H69K, T74S, L89M, I93L  
>00BW1471| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Novitsky, V Human immunodeficiency virus type 1 subtype C molecular phylogeny: consensus sequence for an AIDS vaccine design? J Virol, 2002