<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
99BW3932 99BW3932 Botswana 1999 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    Q9R, D25E, V31I, M50T, I72V, L101I, T112V, T124A, T125A, K136Q, V201I, K211R, T218I, K219Q, L234I, R269K, D278A  
>99BW3932| codons 1-288
FLDGIDKAREEHEKYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEATHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTRELQKQIIQIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIKDYGKQMAGADCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  F53L T12P, I15V, L19I, M36I, R41K, I62V, L63V, G68E, H69K, A71T, I93L  
>99BW3932| codons 1-99
PQITLWQRPLVPIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGLIKVRQYD
QVVIEICEKKTIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, S48E, L100X, K122E, E138A, E169K, K173E, D177E, I178M, R199T, T200A, Q207D, R211G, V245Q, D250E, A272P, K277R, T286A, E291D, V292I, I293V, I309L, A327T, Q334H, G335D, R356K, G359S, Q373H, T377M, K390R, A400T, E404D, V435G, A437V, L452V, R461K, V467I, S468T, L469I, T470N, D471E, H483Y, L491S, S519N, K530R, A534S, A554S T362P
>99BW3932| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGFKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILKPFREQNPEMVI
YQYMDDLYVGSDLEIGQHTAKIEELRDHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENRELLKEPVHGVYYDPSKDLITEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRSA
HPNDVKQLTEAVHKIAMESIVIWGKTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIGGVETFYVDGAANRETKVGKAGYVTDKGRQKVITINETTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Novitsky, V Human immunodeficiency virus type 1 subtype C molecular phylogeny: consensus sequence for an AIDS vaccine design? J Virol, 2002