<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
96BWMO1 96BWMO1 Botswana 1996 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, D25E, V31I, M50I, I84M, T112I, T124A, T125A, K136Q, V201I, K211R, T218I, S230N, L234I, D256E, D278A S283G
>96BWMO1| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYMEAEVIPAETGQETAYFLLKLAGRWPVKIIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTRELQKQIIKIQNFRVYYRDNRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGADCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36V, R41K, L63P, H69K, K70R, L89M, I93L  
>96BWMO1| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEVNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K122E, D123G, P170L, K173A, Q174K, D177E, T200A, Q207E, R211K, K238Q, V245Q, D250E, A272P, K277R, T286A, E291D, V292I, I293V, E297D, K311R, Q334H, G335D, R356K, M357R, G359T, T377L, T386I, K390R, E399D, A400T, E404D, V435L, L452M, S468P, D471E, H483Q, L491S, G504K, S519N, E529D, K530R, A534S, A554S I380T
>96BWMO1| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILELFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDQWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTDEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVKQLTEAVQKIALESTVIWGKIPKFRLPIQKETWDTWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPILGAETFYVDGAANRETKMGKAGYVTDRGRQKVVPLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALKIIQAQPDKSESELVNQIIEQLIKKDRVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Novitsky, V Human immunodeficiency virus type 1 subtype C molecular phylogeny: consensus sequence for an AIDS vaccine design? J Virol, 2002