<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MALCG MALMALCG DRC 1985 HIV1 A PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    V31I, L74I, L101I, T112V, I113V, T124A, T125A, G134N, D167E, V201I, I203M, S230N, L234I S283G, R284G
>MALMALCG| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIIIVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWANIKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDMIATDIQTKELQKQITKIQNFRVYYRDNRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGGQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, I15V, M36I, R41K, H69K, V75I, L89M  
>MALMALCG| codons 1-99
PQITLWQRPVVTVRVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTILVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, T39K, E40D, S48L, K122E, K173T, Q174K, D177E, Q207E, R211K, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, P345Q, F346Y, M357I, R358K, G359S, T377Q, K390R, K431T, L452K, D471E, L491S, L517I, S519N, K527Q, E529D, A534S, A554S D76N
>MALMALCG| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICKDMEKEGKILKIGPENPYNTPV
FAIKKKDSTKWRKLVNFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEQYKNLKTGKYARIKSA
HTNDVKQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIVGAETFYVDGAANRETKKGKAGYVTDRGRQKVVSLTETTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEQLIQKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Alizon, M Genetic variability of the AIDS virus: nucleotide sequence analysis of two isolates from African patients. Cell, 1986