<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ELI ELI Zaire 1983 HIV1 D PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, I72V, T112V, I113V, T124A, T125A, K188R, G189R, V201I, T218I, L234I, N254K, A265V  
>ELI| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRRRGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDKSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, R41K, L63P, H69Q  
>ELI| codons 1-99
PQITLWQRPLVAIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, V60I, K122E, D177E, I178M, E204K, Q207E, P243S, V245K, D250E, K259N, K263R, A272P, K277R, Q334H, T369A, K374R, A376S, K385R, K390R, A400T, T403A, V435I, S468P, H483N, S519N, A554Q P133S, T216R, G262E
>ELI| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTISSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEKLREHLLRWGFTRPDKKHQKEPPFLWMGYELHPDKWT
VQSIKLPEKESWTVNDIQNLVERLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLAEAVQRISTESIVIWGRTPKFRLPIQKETWETWWAEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AINLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSQGIRKVL

References
Author Title Citation
Alizon, M Genetic variability of the AIDS virus: nucleotide sequence analysis of two isolates from African patients. Cell, 1986