<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
R77 R77 Cuba 1999 HIV1 G PBMC None

Treatment History
Order Regimen Weeks
1 Unknown NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, S24N, V31I, T112V, S119P, T122I, T124A, T125A, G134N, K136T, V201I, T206S, L234I, S255N, D256E S283G
>R77| codons 1-288
FLDGIDKAQEDHERYHSNWRAMANDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGPN
FISAAVKAACWWANITQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNNEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, H69K, V82I, L89M, T96P  
>R77| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCPLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S3R, P14S, S48A, K122E, D123N, I135T, S162C, D177E, R211K, F214L, V245Q, E248D, A272P, K277R, I293V, E297T, I326T, M357I, R358K, T377Q, K390R, T403M, T450N, R463K, S468P, H483L, A554S K30E
>R77| codons 2-560
IRPIETVPVKLKSGMDGPKVKQWPLTEEEIKALVEICTEMEKEGKIAKIGPENPYNTPVF
AIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
ENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVIY
QYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTTEAEL
ELAENREILKEPVHGVYYDPSKDLTAEIQKQGQGQWTYQIYQEPFKNLKTGKYARIKGAH
TNDVKQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWEAWWMEYWQATWIPEWEFVNTPP
LVKLWYQLEKEPIVGAETFYVDGAANRENKLGKAGYVTDRGKQKVVPLTDTTNQKTELQA
ILLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHKG
IGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Sierra, M Identification of 3 phylogenetically related HIV-1 BG intersubtype circulating recombinant forms in Cuba. JAIDS, 2007