<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KSM4030 KSM4030 Kenya 2000 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, I72V, L101I, T112V, I113V, T124G, T125A, V126F, K136Q, D167E, V201I S283G
>KSM4030| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVVHTDNGSN
FTSGAFKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20R, E35D, M36I, N37D, R41K, R57K, H69K, L89M  
>KSM4030| codons 1-99
PQITLWQRPLVTVRIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6K, K11T, K20R, V21I, V35T, T39K, K122E, D123S, K173S, D177G, V179I, I202V, Q207A, R211N, V245Q, E248N, K281R, T286A, E291D, V292I, I293V, E312N, G335D, M357K, G359S, T369A, A371V, I375V, A376V, T377K, A400T, T403M, E404D, E432D, I434L, V435E, G436R, A437V, D471E, T477A, Q480H, L491S, K512R, L517I, S519N, Q524K, K527E, E529D, A534S, A554S, V559I K374A
>KSM4030| codons 1-560
PISPIKTVPVTLKPGMDGPRIKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPGIII
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLNWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVPLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVKQLAEVVQAVVKESIVIWGKTPKFKLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPLERVETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKAELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEIVNQIIEKLIEKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKIL

References
Author Title Citation
Dowling, WE Forty-one near full-length HIV-1 sequences from Kenya reveal an epidemic of subtype A and A-containing recombinants. AIDS, 2002