<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BOL122 BOL122 Bolivia 1999 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E10D, M22I, E35Q, S39N, L45V, L101I, T124N, T125A, I135V, K156N  
>BOL122| codons 1-288
FLDGIDKAQDEHEKYHSNWRAIASDFNLPPVVAKQIVANCDKCQVKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSNAVKAACWWAGVKQEFGIPYNPQSQGVVESMNNELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I15V, E35D, R41K, R57K, L63P  
>BOL122| codons 1-99
PQITLWQRPLVKIKVGGQLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K101R, K122E, I135T, S162C, R211K, F214L, E248H, A272P, I329L, Q334E, Y342F, E344D, M357A, R358K, V365I, A400T, E432D, V435E, A437V, D460N, H483Y, L491P, K512R, L517I, I556V  
>BOL122| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPHKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGEGQWTYQIFQDPFKNLKTGKYARAKGA
HTNDIKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIEGVETFYVDGAANRETKLGKAGYVTNRGRQKVVSLTDTTNQKTELQ
AIYLALQDSGPEVNIVTDSQYALGIIQAQPDRSESEIVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGVRKVL

References
Author Title Citation
Carr, JK Diverse BF recombinants have spread widely since the introduction of HIV-1 into South America. AIDS, 2001